K. Furuya et al., ISOLATION AND IDENTIFICATION OF A DIURETIC HORMONE FROM THE MEALWORM TENEBRIO-MOLITOR, Proceedings of the National Academy of Sciences of the United Statesof America, 92(26), 1995, pp. 12323-12327
A diuretic hormone of unusual structure was isolated from extracts of
whole heads of the mealworm Tenebrio molitor. The hormone is a 37-aa p
eptide of 4371 Da, with the sequence SPTISITAPIDVLRKTWEQERARKQMVKNREFL
NSLN. This peptide increases cAMP production in Malpighian tubules of
T. molitor. The amino acid sequence reveals that this peptide is a mem
ber of the family of sauvagine/corticotropin-releasing factor/urotensi
n I-related insect diuretic hormones. The C-terminal sequence of this
peptide is quite different from other members of this family, which ha
ve a hydrophobic C terminus (isoleucinamide or valinamide). When align
ed comparably, T. molitor diuretic hormone has a more hydrophilic C te
rminus, leucylasparagine (free acid), In contrast to all other known d
iuretic hormones of this family, this peptide has exceptionally low st
imulatory activity on cAMP production in Malpighian tubules of Manduca
sexta. However, at nanomolar concentrations it stimulates cAMP produc
tion in Malpighian tubules of T. molitor. Diuretic hormones of this fa
mily have been isolated previously from Lepidoptera, Orthoptera, Dicty
optera, and Diptera. This appears to be the first diuretic hormone iso
lated from a coleopteran insect.